geoscience.net logo
+ Resolve Article
+ Follow Us
Follow on FacebookFollow on Facebook
Follow on TwitterFollow on Twitter

+ Translate
+ Subscribe to Site Feed
GeoScience Most Shared ContentMost Shared Content

A novel human metalloprotease synthesized in the liver and secreted into the blood: possibly, the von Willebrand factor-cleaving protease?


, : A novel human metalloprotease synthesized in the liver and secreted into the blood: possibly, the von Willebrand factor-cleaving protease?. Journal of Biochemistry 130(4): 475-480

We identified a novel metalloprotease, which could be responsible for cleaving the Tyr842-Met843 peptide bond of von Willebrand factor (vWF). This metalloprotease was purified from Cohn Fraction-I precipitate of human pooled plasma by the combination of gel filtration, DEAE chromatography, and preparative polyacrylamide gel electrophoresis in the presence of SDS. The NH2-terminal amino acid sequence of the isolated protein was: AAGGILHLELLVAVGPDVFQAHQEDTRRY. Based on this sequence, we searched human genomic and EST databases, and identified compatible nucleotide sequences. These results suggested that this protein is a novel metalloprotease, a member of the family of a disintegrin and metalloprotease with thrombospondin type-1 motifs (ADAMTS), and its genomic DNA was mapped to human chromosome 9q34. Multiple human tissue northern blotting analysis indicated that the mRNA encoding this protease spanned approximately 5 kilobases and was uniquely expressed in the liver. Furthermore, we determined the cDNA sequence encoding this protease, and found that this protease was comprised of a signal peptide, a proregion followed by the putative furin cleavage site, a reprolysin-type zinc-metalloprotease domain, a disintegrin-like domain, a thrombospondin type-1 (TSP1) motif, a cysteine-rich region, a spacer domain, and COOH-terminal TSP1 motif repeats.

US$19.90

PMID: 11574066

DOI: 10.1093/oxfordjournals.jbchem.a003009


Other references

Ellsworth, R.K.; Aronoff, S., 1969: Investigations of the biogenesis of chlorophyll a. IV. Isolation and partial characterization of some biosynthetic intermediates between Mg-protoporphine IX monomethyl ester and Mg-vinylpheoporphine a5, obtained from Chlorella mutants. Archives of Biochemistry and Biophysics 130(1): 374-383

Bulletti, C., 1996: Debating tubal transfer in assisted reproductive technologies. Human Reproduction 11(9): 1820-1822

Muszalski, K., 1977: Radial honey extractor for making by the beekeeper. Pszczelarstwo 28 (11) 11

da Silva, Bárbara.Pereira.; Anunciação, P.Cristine.; Matyelka, J.Camila.da.Silva.; Della Lucia, C.Mattos.; Martino, Hércia.Stampini.Duarte.; Pinheiro-Sant'Ana, H.Maria., 2017: Chemical composition of Brazilian chia seeds grown in different places. This study investigated and compared the occurrence and concentration of macronutrients, moisture, ash, dietary fiber, fatty acids, minerals, carotenoids, vitamins, flavonoids, phenolic compounds, antioxidant activity, phytate and tannin in Brazil...

Miike, L., 1977: State medical licensing boards: expanding or contracting roles?. Legal Medicine Annual: 257-268

Sunohara, Y.; Matsumoto, H.; Ikeda, H.; Noma, Y., 1999: Effect of temperature on quinclorac-induced ethylene production from corn leaves. Growth cabinet experiments indicated that not only the temperature (20 or 30 degrees C) after quinclorac treatment, but also that prior to herbicide treatment, significantly influenced quinclorac-induced ethylene production from corn [maize] cv. H...

Norman, A.M., 1868: Notes on some British Polyzoa, with descriptions of some new species. Hemeschara struma, sp. n., Norman, l. c. p. 221, pl. 7. figs. 6-8, 100 fathoms, 25 miles north of Island of Unst .H. sanguinea, sp. n., Norman, l. c. p. 222, pl. 7. figs. 9-11, Fermain Bay, Guernsey, on shells. .Celleporella lepralioides, sp. n.,...

Shih, M.C., 1994: Cloning and sequencing of a cDNA clone encoding the cytosolic triose-phosphate isomerase from Arabidopsis thaliana. Plant Physiology 104(3): 1103-1104

von Salisch, M.; Schäfer, M., 2013: Friendship and peer relations. Praxis der Kinderpsychologie und Kinderpsychiatrie 62(3): 169-170

Kim, H.J.; Kang, C.H.; Kim, Y.T.; Sung, S-W.; Kim, J.H.; Lee, S.M.; Yoo, C-G.; Lee, C-T.; Kim, Y.W.; Han, S.K.; Shim, Y-S.; Yim, J-J., 2006: Prognostic factors for surgical resection in patients with multidrug-resistant tuberculosis. Although surgical lung resection could improve prognosis in some patients with multidrug-resistant tuberculosis (MDR-TB), there are no reports on the optimal candidates for this surgery. The aim of the present study was to elucidate the prognostic...